ALX4 Rabbit Polyclonal Antibody

CAT#: TA341710

Rabbit Polyclonal Anti-ALX4 Antibody

Product Images

WB Suggested Anti-ALX4 Antibody Titration: 0.625 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the N terminal of human ALX4. Synthetic peptide located within the following region: SSPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQQDLATPLESG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: ALX homeobox 4
• Database Link:
  NP_068745
  Entrez Gene 60529 Human
  UniProt ID Q9H161
• Background: This gene encodes a paired-like homeodomain transcription factor expressed inThe mesenchyme of developing bones, limbs, hair, teeth, and mammary tissue. Mutations inThis gene cause parietal foramina 2 (PFM2); an autosomal dominant disease characterized by deficient ossification ofThe parietal bones. Mutations inThis gene also cause a form of frontonasal dysplasia with alopecia and hypogonadism; suggesting a role forThis gene in craniofacial development, mesenchymal-epithelial communication, and hair follicle development. Deletion of a segment of chromosome 11 containingThis gene, del(11)(p11p12), causes Potocki-Shaffer syndrome (PSS); a syndrome characterized by craniofacial anomalies, mental retardation, multiple exostoses, and genital abnormalities in males. In mouse,This gene has been shown to use dual translation initiation sites located 16 codons apart. [provided by RefSeq, Oct 2009]
• Synonyms: CRS5; FND2
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rat: 91%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome