ALX4 Rabbit Polyclonal Antibody

CAT#: TA341711

Rabbit Polyclonal Anti-ALX4 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ALX4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the C terminal of human ALX4. Synthetic peptide located within the following region: SVSGAGSHVGQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 44 kDa
Gene Name ALX homeobox 4
Background This gene encodes a paired-like homeodomain transcription factor expressed inThe mesenchyme of developing bones, limbs, hair, teeth, and mammary tissue. Mutations inThis gene cause parietal foramina 2 (PFM2); an autosomal dominant disease characterized by deficient ossification ofThe parietal bones. Mutations inThis gene also cause a form of frontonasal dysplasia with alopecia and hypogonadism; suggesting a role forThis gene in craniofacial development, mesenchymal-epithelial communication, and hair follicle development. Deletion of a segment of chromosome 11 containingThis gene, del(11)(p11p12), causes Potocki-Shaffer syndrome (PSS); a syndrome characterized by craniofacial anomalies, mental retardation, multiple exostoses, and genital abnormalities in males. In mouse,This gene has been shown to use dual translation initiation sites located 16 codons apart. [provided by RefSeq, Oct 2009]
Synonyms CRS5; FND2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 91%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.