ADAR1 (ADAR) Rabbit Polyclonal Antibody

CAT#: TA341714

Rabbit Polyclonal Anti-ADAR Antibody


USD 375.00

2 Weeks*

Size
    • 100 ul

Product Images

Other products for "ADAR"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ADAR antibody: synthetic peptide directed towards the N terminal of human ADAR. Synthetic peptide located within the following region: GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 136 kDa
Gene Name adenosine deaminase, RNA-specific
Background This gene encodes a protein that sorts transmembrane proteins into lysosomes/vacuoles viaThe multivesicular body (MVB) pathway.This protein, along with other soluble coiled-coil containing proteins, forms part ofThe ESCRT-III protein complex that binds toThe endosomal membrane and recruits additional cofactors for protein sorting intoThe MVB.This protein may also co-immunoprecipitate with a member ofThe IFG-binding protein superfamily. Alternative splicing results in multiple transcript variants. Read-through transcription also exists betweenThis gene andThe upstream ring finger protein 103 (RNF103) gene. [provided by RefSeq, Nov 2010]
Synonyms ADAR1; AGS6; DRADA; DSH; DSRAD; G1P1; IFI-4; IFI4; K88DSRBP; P136
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome
Protein Pathways Cytosolic DNA-sensing pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.