TRPC6 Rabbit Polyclonal Antibody
Other products for "TRPC6"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the C terminal of human TRPC6. Synthetic peptide located within the following region: GHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 107 kDa |
Gene Name | transient receptor potential cation channel subfamily C member 6 |
Database Link | |
Background | The protein encoded byThis gene forms a receptor-activated calcium channel inThe cell membrane.The channel is activated by diacylglycerol and is thought to be underThe control of a phosphatidylinositol second messenger system. Activation ofThis channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects inThis gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2). [provided by RefSeq, Mar 2009] |
Synonyms | FSGS2; TRP6 |
Note | Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.