GABA A Receptor gamma 2 (GABRG2) Rabbit Polyclonal Antibody

CAT#: TA341718

Rabbit Polyclonal Anti-GABRG2 Antibody

Product Images

Host: Rabbit; Target Name: GABRG2; Sample Tissue: Esophagus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GABRG2 antibody is: synthetic peptide directed towards the N-terminal region of Human GABRG2. Synthetic peptide located within the following region: VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINME
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: gamma-aminobutyric acid type A receptor gamma2 subunit
• Database Link:
  NP_944494
  Entrez Gene 2566 Human
  UniProt ID P18507
• Background: This gene encodes a gamma-aminobutyric acid (GABA) receptor. GABA isThe major inhibitory neurotransmitter inThe mammlian brain, where it acts at GABA-A receptors, which are ligand-gated chloride channels. GABA-A receptors are pentameric, consisting of proteins from several subunit classes: alpha, beta, gamma, delta and rho. Mutations inThis gene have been associated with epilepsy and febrile seizures. Multiple transcript variants encoding different isoforms have been identified forThis gene. [provided by RefSeq, Jul 2008]
• Synonyms: CAE2; ECA2; GEFSP3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction