MDC1 Rabbit Polyclonal Antibody

CAT#: TA341734

Rabbit Polyclonal Anti-MDC1 Antibody

Product Images

WB Suggested Anti-MDC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: HepG2 cell lysateMDC1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MDC1 antibody: synthetic peptide directed towards the C terminal of human MDC1. Synthetic peptide located within the following region: GKEEDVVTPKPGKRKRDQAEEEPNRIPSRSLRRTKLNQESTAPKVLFTGV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 227 kDa
• Gene Name: mediator of DNA damage checkpoint 1
• Database Link:
  NP_055456
  Entrez Gene 9656 Human
  UniProt ID Q14676
• Background: The protein encoded byThis gene contains an N-terminal forkhead domain, two BRCA1 C-terminal (BRCT) motifs and a central domain with 13 repetitions of an approximately 41-amino acid sequence.The encoded protein is required to activateThe intra-S phase and G2/M phase cell cycle checkpoints in response to DNA damage.This nuclear protein interacts with phosphorylated histone H2AX near sites of DNA double-strand breaks through its BRCT motifs, and facilitates recruitment ofThe ATM kinase and meiotic recombination 11 protein complex to DNA damage foci. [provided by RefSeq, Jul 2008]
• Synonyms: NFBD1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Guinea pig: 92%; Dog: 86%