PTOP (ACD) Rabbit Polyclonal Antibody

CAT#: TA341742

Rabbit Polyclonal Anti-Acd Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Acd antibody: synthetic peptide directed towards the c terminal of mouse Acd. Synthetic peptide located within the following region: PRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 45
Gene Name adrenocortical dysplasia homolog
Background Acd is a component ofThe shelterin complex (telosome) that is involved inThe regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden fromThe DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways.Acd promotes binding of POT1 to single-stranded telomeric DNA.Acd modulatesThe inhibitory effects of POT1 on telomere elongation.The ACD-POT1 heterodimer enhances telomer elongation by increasing telomerase processivity.Acd plays a role in shelterin complex assembly. Acd may play an essential role in organogenesis ofThe developing embryo.
Synonyms PIP1; PTOP; TINT1; TPP1
Note Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Dog: 85%; Pig: 85%; Horse: 85%; Human: 85%; Guinea pig: 85%; Bovine: 83%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.