PTOP (ACD) Rabbit Polyclonal Antibody

CAT#: TA341742

Rabbit Polyclonal Anti-Acd Antibody

Product Images

WB Suggested Anti-Acd Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Acd antibody: synthetic peptide directed towards the c terminal of mouse Acd. Synthetic peptide located within the following region: PRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45
• Gene Name: adrenocortical dysplasia homolog
• Database Link:
  NP_001075955
  Entrez Gene 497652 Mouse
  UniProt ID Q96AP0
• Background: Acd is a component ofThe shelterin complex (telosome) that is involved inThe regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden fromThe DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways.Acd promotes binding of POT1 to single-stranded telomeric DNA.Acd modulatesThe inhibitory effects of POT1 on telomere elongation.The ACD-POT1 heterodimer enhances telomer elongation by increasing telomerase processivity.Acd plays a role in shelterin complex assembly. Acd may play an essential role in organogenesis ofThe developing embryo.
• Synonyms: PIP1; PTOP; TINT1; TPP1
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Dog: 85%; Pig: 85%; Horse: 85%; Human: 85%; Guinea pig: 85%; Bovine: 83%