ALX4 Rabbit Polyclonal Antibody

CAT#: TA341743

Rabbit Polyclonal Anti-Alx4 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ALX4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Alx4 antibody: synthetic peptide directed towards the middle region of mouse Alx4. Synthetic peptide located within the following region: EPELPPDSEPVGMDNSYLSVKETGAKGPQDRASAEIPSPLEKTDSESNKG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 43
Gene Name ALX homeobox 4
Background Transcription factor involved in skull and limb development.
Synonyms CRS5; FND2
Note Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Human: 86%; Bovine: 86%; Guinea pig: 86%; Horse: 79%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.