Elf3 Rabbit Polyclonal Antibody

CAT#: TA341758

Rabbit Polyclonal Anti-Elf3 Antibody

Product Images

WB Suggested Anti-Elf3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Trachea

• 

  Mouse Stomach

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the N terminal of mouse Elf3. Synthetic peptide located within the following region: MAATCEISNVFSNYFNAMYSSEDPTLAPAPPTTFGTEDLVLTLNNQQMTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: E74-like factor 3
• Database Link:
  NP_031947
  Entrez Gene 1999 HumanEntrez Gene 13710 Mouse
  UniProt ID Q3UPW2
• Background: Elf3 is a transcriptional activator that binds and transactivates ETS sequences containingThe consensus nucleotide core sequence GGA[AT]. It acts synergistically with POU2F3 to transactivateThe SPRR2A promoter and with RUNX1 to transactivateThe ANGPT1 promoter (By similarity). It also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. IT represses KRT4 promoter activity (By similarity). It may play an important role in epithelial cell differentiation and tumorigenesis and may be a critical downstream effector ofThe ERBB2 signaling pathway (By similarity). It may be associated with mammary gland development and involution. It plays an important role inThe regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development.
• Synonyms: EPR-1; ERT; ESE-1; ESX; JEN; OTTHUMP00000034052
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%