ESE1 (ELF3) Rabbit Polyclonal Antibody

CAT#: TA341759

Rabbit Polyclonal Anti-Elf3 Antibody

Product Images

WB Suggested Anti-Elf3 Antibody Titration: 0.2-1 ug/ml; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Elf3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TATPQSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: E74 like ETS transcription factor 3
• Database Link:
  NP_004424
  Entrez Gene 13710 Mouse
  UniProt ID P78545
• Background: Elf3 is a transcriptional activator that binds and transactivates ETS sequences containingThe consensus nucleotide core sequence GGA[AT]. Elf3 acts synergistically with POU2F3 to transactivateThe SPRR2A promoter and with RUNX1 to transactivateThe ANGPT1 promoter.Elf3 also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. Elf3 represses KRT4 promoter activity.Elf3 is involved in mediating vascular inflammation. Elf3 may play an important role in epithelial cell differentiation and tumorigenesis. Elf3 may be a critical downstream effector ofThe ERBB2 signaling pathway. Elf3 may be associated with mammary gland development and involution. Elf3 plays an important role inThe regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development.
• Synonyms: EPR-1; ERT; ESE-1; ESX
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 92%; Bovine: 92%; Guinea pig: 92%; Human: 77%

Reference Data

• Protein Families: Transcription Factors