FOXC1 Rabbit Polyclonal Antibody

CAT#: TA341795

Rabbit Polyclonal Anti-Foxc1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "FOXC1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Foxc1 antibody: synthetic peptide directed towards the n terminal of mouse Foxc1. Synthetic peptide located within the following region: MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 57
Gene Name forkhead box C1
Background Transcriptional regulator. Regulates FOXO1 through binding to a conserved element, 5'-GTAAACAAA-3' in its promoter region, implicating FOXC1 as an important regulator of cell viability and resistance to oxidative stress inThe eye.
Synonyms ARA; FKHL7; FREAC-3; FREAC3; IGDA; IHG1; IRID1; RIEG3
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Dog: 86%; Horse: 86%; Bovine: 86%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.