Germany
Japan
United Kingdom
China
Neo1 Rabbit Polyclonal Antibody
Product Images
Other products for "Neo1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Mouse |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-Neo1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Neo1. Synthetic peptide located within the following region: PPPPLLLLLPLLLLLGRPASGAAATKSGSPPQSAGASVRTFTPFYFLVEP |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 163 kDa |
| Gene Name | neogenin |
| Database Link | |
| Background | The function ofThis protein remains unknown. |
| Synonyms | DKFZp547A066; DKFZp547B146; HsT17534; IGDCC2; NGN |
| Note | Immunogen Sequence Homology: Mouse: 100% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.