NKX2.3 (NKX2-3) Rabbit Polyclonal Antibody

CAT#: TA341800

Rabbit Polyclonal Anti-NKX2-3 Antibody

Product Images

WB Suggested Anti-NKX2-3 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NKX2-3 antibody: synthetic peptide directed towards the middle region of mouse NKX2-3. Synthetic peptide located within the following region: GTHAPPPPPRRVAVPVLVRDGKPCVTPSAQTYGSPYGVGAGAYSYNSFPA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: NK2 homeobox 3
• Database Link:
  NP_660328
  Entrez Gene 18089 Mouse
  UniProt ID Q8TAU0
• Background: NKX2C is a member ofThe NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions.
• Synonyms: CSX3; NK2.3; NKX2.3; NKX2C; NKX4-3
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 85%; Pig: 85%; Bovine: 85%; Guinea pig: 85%; Human: 77%

Reference Data

• Protein Families: Transcription Factors