c Rel (REL) Rabbit Polyclonal Antibody

CAT#: TA341808

Rabbit Polyclonal Anti-Rel Antibody

Product Images

WB Suggested Anti-Rel Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Lung

• 

  WB Suggested Anti-REL Antibody ; Positive Control: Lane 1: 100ug mouse liver, Lane 2: 100ug mouse brain, Lane 3: 100ug mouse heart, Lane 4: 100ug mouse kidney, Lane 5: 100ug mouse lung, Lane 6: 100ug mouse thymus, Lane 7: 100ug mouse spleen, Lane 8: 100ug mouse t

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rel antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: REL proto-oncogene, NF-kB subunit
• Database Link:
  NP_002899
  Entrez Gene 19696 MouseEntrez Gene 5966 Human
  UniProt ID Q04864
• Background: The function ofThis protein remains unknown.
• Synonyms: C-Rel
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Human: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors