Thrb Rabbit Polyclonal Antibody

CAT#: TA341822

Rabbit Polyclonal Anti-Thrb Antibody

Product Images

WB Suggested Anti-Thrb Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Muscle

• 

  Application: ChIP; Sample Type: mouse liver tissue; Chromatin Used: 100ug tissue; Antibody Used: 10ug ; Image Submitted by: Joanna DiSpirito; University of Pennsylvania

• 

  Application: ChIP; Sample Type: mouse liver tissue; Chromatin Used: 100ug tissue; Antibody Used: 10ug ; Image Submitted by: Joanna DiSpirito; University of Pennsylvania

Specifications

Product Data

• Applications: Assay, WB
• Recommended Dilution: WB, ChIP
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Thrb antibody: synthetic peptide directed towards the n terminal of mouse Thrb. Synthetic peptide located within the following region: MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54
• Gene Name: thyroid hormone receptor beta
• Database Link:
  NP_033406
  Entrez Gene 21834 Mouse
  UniProt ID P37242
• Background: Nuclear hormone receptor that can act as a repressor or activator of transcription. High affinity receptor for thyroid hormones, including triiodothyronine and thyroxine.
• Synonyms: ERBA-BETA; ERBA2; GRTH; MGC126109; MGC126110; NR1A2; OTTHUMP00000208475; OTTHUMP00000208531; PRTH; THR1; THRB1; THRB2
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 86%