TOB (TOB1) Rabbit Polyclonal Antibody

CAT#: TA341823

Rabbit Polyclonal Anti-TOB1 Antibody

Product Images

WB Suggested Anti-TOB1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TOB1 antibody: synthetic peptide directed towards the middle region of mouse TOB1. Synthetic peptide located within the following region: QPLTFTTATFAATKFGSTKMKNSGRSSKVARTSPINLGLTVNVNDLLKQK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: transducer of ERBB2, 1
• Database Link:
  NP_005740
  Entrez Gene 22057 Mouse
  UniProt ID P50616
• Background: Anti-proliferative protein;The function is mediated by association with deadenylase subunits ofThe CCR4-NOT complex.
• Synonyms: APRO5; APRO6; PIG49; TOB; TROB; TROB1
• Note: Immunogen Sequence Homology: Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Human: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome