Nr1i3 Rabbit Polyclonal Antibody

CAT#: TA341839

Rabbit Polyclonal Anti-NR1I3 Antibody

Product Images

WB Suggested Anti-NR1I3 Antibody Titration: 5.0 ug/ml; Positive Control: SP2/0 cell lysate

• 

  Mouse Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the C terminal of mouse NR1I3. Synthetic peptide located within the following region: QQSRLQSRFLYAKLMGLLADLRSINNAYSYELQRLEELSAMTPLLGEICS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: nuclear receptor subfamily 1, group I, member 3
• Database Link:
  NP_033933
  Entrez Gene 12355 Mouse
  UniProt ID O35627
• Background: NR1I3 mediatesThe induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses.
• Synonyms: CAR; CAR1; MB67; MGC97144; MGC97209; MGC150433; OTTHUMP00000032246
• Note: Immunogen Sequence Homology: Mouse: 100%