AFG3L2 Rabbit Polyclonal Antibody

CAT#: TA341861

Rabbit Polyclonal Anti-AFG3L2 Antibody

Product Images

WB Suggested Anti-AFG3L2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Hela cell lysate.AFG3L2 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AFG3L2 antibody: synthetic peptide directed towards the middle region of human AFG3L2. Synthetic peptide located within the following region: VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 88 kDa
• Gene Name: AFG3 like matrix AAA peptidase subunit 2
• Database Link:
  NP_006787
  Entrez Gene 10939 Human
  UniProt ID Q9Y4W6
• Background: This gene encodes a protein localized in mitochondria and closely related to paraplegin.The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia.This gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders. [provided by RefSeq, Jul 2008]
• Synonyms: SCA28; SPAX5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 85%; Goat: 79%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane