TMED1 Rabbit Polyclonal Antibody

CAT#: TA341867

Rabbit Polyclonal Anti-TMED1 Antibody

Product Images

WB Suggested Anti-TMED1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate.TMED1 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMED1 antibody: synthetic peptide directed towards the middle region of human TMED1. Synthetic peptide located within the following region: FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: transmembrane p24 trafficking protein 1
• Database Link:
  NP_006849
  Entrez Gene 11018 Human
  UniProt ID Q13445
• Background: This gene belongs toThe TMED (transmembrane emp24 domain-containing) protein family, which is involved inThe vesicular trafficking of proteins.The protein encoded byThis gene was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1) and may play a role in innate immunity.This protein lacks any similarity to other interleukin 1 ligands. Alternative splicing results in multiple transcript variants ofThis gene. [provided by RefSeq, Jul 2013]
• Synonyms: Il1rl1l; IL1RL1LG; p24g1; Tp24
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane