Tmed1 Rabbit Polyclonal Antibody

CAT#: TA341868

Rabbit Polyclonal Anti-Tmed1 Antibody

Product Images

WB Suggested Anti-Tmed1 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Lung

• 

  Lanes: Lane 1 and 2: 30 ug HEK-293 cell lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-Rabbit HRP; Secondary Antibody Dilution: 1: 2000; Gene Name: Tmed1; Submitted by: Anonymous;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Tmed1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: EAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: transmembrane p24 trafficking protein 1
• Database Link:
  NP_001013450
  Entrez Gene 11018 HumanEntrez Gene 315461 Rat
  UniProt ID Q5BK85
• Background: Potential role in vesicular protein trafficking, mainly inThe early secretory pathway. May act as a cargo receptor atThe lumenal side for incorporation of secretory cargo molecules into transport vesicles and may be involved in vesicle coat formation atThe cytoplasmic side.
• Synonyms: Il1rl1l; IL1RL1LG; MGC1270; ST2L
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 91%