ST3GAL2 Rabbit Polyclonal Antibody

CAT#: TA341870

Rabbit Polyclonal Anti-ST3GAL2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ST3GAL2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ST3GAL2 antibody: synthetic peptide directed towards the C terminal of human ST3GAL2. Synthetic peptide located within the following region: ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40 kDa
Gene Name ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Background The protein encoded byThis gene is a type II membrane protein that catalyzesThe transfer of sialic acid from CMP-sialic acid to galactose-containing substrates.The encoded protein is normally found inThe Golgi but can be proteolytically processed to a soluble form.This protein, which is a member of glycosyltransferase family 29, can useThe same acceptor substrates as does sialyltransferase 4A. [provided by RefSeq, Jul 2008]
Synonyms Gal-NAc6S; SIAT4B; ST3GalA.2; ST3GALII
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Families Transmembrane
Protein Pathways Glycosphingolipid biosynthesis - ganglio series, Glycosphingolipid biosynthesis - globo series, Keratan sulfate biosynthesis, Metabolic pathways, O-Glycan biosynthesis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.