RER1 Rabbit Polyclonal Antibody

CAT#: TA341877

Rabbit Polyclonal Anti-RER1 Antibody

Product Images

WB Suggested Anti-RER1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate

• 

  Rabbit Anti-RER1 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, strong signal, very wide tissue distribution; Primary Antibody Concentration: 1: 100; Secondary Antibody: Donkey anti-Rabbi

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RER1 antibody: synthetic peptide directed towards the middle region of human RER1. Synthetic peptide located within the following region: GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: retention in endoplasmic reticulum sorting receptor 1
• Database Link:
  NP_008964
  Entrez Gene 11079 Human
  UniProt ID O15258
• Background: The protein encoded byThis gene is a multi-pass membrane protein that is localized toThe golgi apparatus. It is involved inThe retention of endoplasmic reticulum (ER) membrane proteins inThe ER and retrieval of ER membrane proteins fromThe early Golgi compartment to facilitate gamma-secretase complex assembly. [provided by RefSeq, Oct 2009]
• Synonyms: RP4-740C4.2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane