LETM1 Rabbit Polyclonal Antibody

CAT#: TA341905

Rabbit Polyclonal Anti-LETM1 Antibody

Product Images

WB Suggested Anti-LETM1 Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate.LETM1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LETM1 antibody: synthetic peptide directed towards the middle region of human LETM1. Synthetic peptide located within the following region: MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: leucine zipper and EF-hand containing transmembrane protein 1
• Database Link:
  NP_036450
  Entrez Gene 3954 Human
  UniProt ID O95202
• Background: This gene encodes a protein that is localized toThe inner mitochondrial membrane.The protein functions to maintainThe mitochondrial tubular shapes and is required for normal mitochondrial morphology and cellular viability. Mutations inThis gene cause Wolf-Hirschhorn syndrome, a complex malformation syndrome caused byThe deletion of parts ofThe distal short arm of chromosome 4. Related pseudogenes have been identified on chromosomes 8, 15 and 19. [provided by RefSeq, Oct 2009]
• Synonyms: leucine zipper-EF-hand containing transmembrane protein 1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 86%

Reference Data

• Protein Families: Transmembrane