ST6GALNAC6 Rabbit Polyclonal Antibody

CAT#: TA341921

Rabbit Polyclonal Anti-ST6GALNAC6 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ST6GALNAC6"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ST6GALNAC6 antibody: synthetic peptide directed towards the C terminal of human ST6GALNAC6. Synthetic peptide located within the following region: YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 38 kDa
Gene Name ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
Background ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides onThe cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]). [supplied by OMIM, Mar 2008]. Transcript Variant:This variant (5) differs inThe 5' UTR, lacks a portion ofThe 5' coding region, and initiates translation from a downstream in-frame start codon, compared to variant 1.The encoded isoform (c) is shorter atThe N-terminus, compared to isoform a. Variants 3, 4 and 5 all encode isoform c. ##Evidence-Data-START## Transcript exon combination :: AK057100.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Synonyms SIAT7-F; SIAT7F; ST6GALNACVI
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Families Transmembrane
Protein Pathways Glycosphingolipid biosynthesis - ganglio series, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.