ST6GALNAC6 Rabbit Polyclonal Antibody
Other products for "ST6GALNAC6"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ST6GALNAC6 antibody: synthetic peptide directed towards the C terminal of human ST6GALNAC6. Synthetic peptide located within the following region: YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 38 kDa |
Gene Name | ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 |
Database Link | |
Background | ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides onThe cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]). [supplied by OMIM, Mar 2008]. Transcript Variant:This variant (5) differs inThe 5' UTR, lacks a portion ofThe 5' coding region, and initiates translation from a downstream in-frame start codon, compared to variant 1.The encoded isoform (c) is shorter atThe N-terminus, compared to isoform a. Variants 3, 4 and 5 all encode isoform c. ##Evidence-Data-START## Transcript exon combination :: AK057100.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end. |
Synonyms | SIAT7-F; SIAT7F; ST6GALNACVI |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Glycosphingolipid biosynthesis - ganglio series, Metabolic pathways |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.