C9ORF4 (FRRS1L) Rabbit Polyclonal Antibody

CAT#: TA341929

Rabbit Polyclonal Anti-C9orf4 Antibody

Product Images

WB Suggested Anti-C9orf4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C9orf4 antibody: synthetic peptide directed towards the middle region of human C9orf4. Synthetic peptide located within the following region: HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: ferric chelate reductase 1 like
• Database Link:
  NP_055149
  Entrez Gene 23732 Human
  UniProt ID Q9P0K9
• Background: The exact function of C9orf4 remains unknown.
• Synonyms: C9orf4; CG-6; CG6
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Transmembrane