Seladin 1 (DHCR24) Rabbit Polyclonal Antibody
Other products for "DHCR24"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-DHCR24 antibody: synthetic peptide directed towards the N terminal of human DHCR24. Synthetic peptide located within the following region: FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 58 kDa |
| Gene Name | 24-dehydrocholesterol reductase |
| Database Link | |
| Background | This gene encodes a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzesThe reduction ofThe delta-24 double bond of sterol intermediates during cholesterol biosynthesis.The protein contains a leader sequence that directs it toThe endoplasmic reticulum membrane. Missense mutations inThis gene have been associated with desmosterolosis. Also, reduced expression ofThe gene occurs inThe temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells. [provided by RefSeq, Jul 2008] |
| Synonyms | DCE; Nbla03646; seladin-1; SELADIN1 |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93% |
| Reference Data | |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Transmembrane |
| Protein Pathways | Metabolic pathways, Steroid biosynthesis |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China