Seladin 1 (DHCR24) Rabbit Polyclonal Antibody

CAT#: TA341955

Rabbit Polyclonal Anti-DHCR24 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "DHCR24"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DHCR24 antibody: synthetic peptide directed towards the N terminal of human DHCR24. Synthetic peptide located within the following region: FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 58 kDa
Gene Name 24-dehydrocholesterol reductase
Background This gene encodes a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzesThe reduction ofThe delta-24 double bond of sterol intermediates during cholesterol biosynthesis.The protein contains a leader sequence that directs it toThe endoplasmic reticulum membrane. Missense mutations inThis gene have been associated with desmosterolosis. Also, reduced expression ofThe gene occurs inThe temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells. [provided by RefSeq, Jul 2008]
Synonyms DCE; Nbla03646; seladin-1; SELADIN1
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome, Stem cell - Pluripotency, Transmembrane
Protein Pathways Metabolic pathways, Steroid biosynthesis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.