CYP2A7 Rabbit Polyclonal Antibody

CAT#: TA341978

Rabbit Polyclonal Anti-TMEM158 Antibody

Product Images

WB Suggested Anti-TMEM158 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM158 antibody: synthetic peptide directed towards the middle region of human TMEM158. Synthetic peptide located within the following region: AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: cytochrome P450 family 2 subfamily A member 7
• Database Link:
  NP_000755
  Entrez Gene 1549 Human
  UniProt ID P20853
• Background: Constitutive activation ofThe Ras pathway triggers an irreversible proliferation arrest reminiscent of replicative senescence. Transcription ofThis gene is upregulated in response to activation ofThe Ras pathway, but not under other conditions that induce senescence.The encoded protein is similar to a rat cell surface receptor proposed to function in a neuronal survival pathway. [provided by RefSeq, Jul 2008]
• Synonyms: CPA7; CPAD; CYP2A; CYPIIA7; P450-IIA4
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%

Reference Data

• Protein Families: Druggable Genome, P450, Transmembrane
• Protein Pathways: Caffeine metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Retinol metabolism