CYP2A7 Rabbit Polyclonal Antibody

CAT#: TA341978

Rabbit Polyclonal Anti-TMEM158 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CYP2A7"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TMEM158 antibody: synthetic peptide directed towards the middle region of human TMEM158. Synthetic peptide located within the following region: AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 30 kDa
Gene Name cytochrome P450 family 2 subfamily A member 7
Background Constitutive activation ofThe Ras pathway triggers an irreversible proliferation arrest reminiscent of replicative senescence. Transcription ofThis gene is upregulated in response to activation ofThe Ras pathway, but not under other conditions that induce senescence.The encoded protein is similar to a rat cell surface receptor proposed to function in a neuronal survival pathway. [provided by RefSeq, Jul 2008]
Synonyms CPA7; CPAD; CYP2A; CYPIIA7; P450-IIA4
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%
Reference Data
Protein Families Druggable Genome, P450, Transmembrane
Protein Pathways Caffeine metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Retinol metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.