COQ2 Rabbit Polyclonal Antibody
Other products for "COQ2"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-COQ2 antibody: synthetic peptide directed towards the middle region of human COQ2. Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 42 kDa |
| Gene Name | coenzyme Q2, polyprenyltransferase |
| Database Link | |
| Background | This gene encodes an enzyme that functions inThe final steps inThe biosynthesis of CoQ (ubiquinone), a redox carrier inThe mitochondrial respiratory chain and a lipid-soluble antioxidant.This enzyme, which is part ofThe coenzyme Q10 pathway, catalyzesThe prenylation of parahydroxybenzoate with an all-trans polyprenyl group. Mutations inThis gene cause coenzyme Q10 deficiency, a mitochondrial encephalomyopathy, and also COQ2 nephropathy, an inherited form of mitochondriopathy with primary renal involvement. [provided by RefSeq, Oct 2009] |
| Synonyms | CL640; COQ10D1; MSA1 |
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Yeast: 91%; Pig: 86%; Rat: 86%; Mouse: 86%; Zebrafish: 86%; Goat: 79%; Horse: 79% |
| Reference Data | |
| Protein Families | Transmembrane |
| Protein Pathways | Ubiquinone and other terpenoid-quinone biosynthesis |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China