C19orf56 (WDR83OS) Rabbit Polyclonal Antibody

CAT#: TA341999

Rabbit Polyclonal Anti-C19orf56 Antibody

Product Images

WB Suggested Anti-C19orf56 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate.WDR83OS is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C19orf56 antibody: synthetic peptide directed towards the N terminal of human C19orf56. Synthetic peptide located within the following region: STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: WD repeat domain 83 opposite strand
• Database Link:
  NP_057229
  Entrez Gene 51398 Human
  UniProt ID Q9Y284
• Background: The exact function of C19orf56 remains unknown.
• Synonyms: C19orf56; PTD008
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane