IMPG2 Rabbit Polyclonal Antibody

CAT#: TA342007

Rabbit Polyclonal Anti-IMPG2 Antibody

Product Images

WB Suggested Anti-IMPG2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IMPG2 antibody: synthetic peptide directed towards the C terminal of human IMPG2. Synthetic peptide located within the following region: VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 138 kDa
• Gene Name: interphotoreceptor matrix proteoglycan 2
• Database Link:
  NP_057331
  Entrez Gene 50939 Human
  UniProt ID Q9BZV3
• Background: The protein encoded byThis gene binds chondroitin sulfate and hyaluronan and is a proteoglycan.The encoded protein plays a role inThe organization ofThe interphotoreceptor matrix and may promoteThe growth and maintenance ofThe light-sensitive photoreceptor outer segment. Defects inThis gene are a cause of retinitis pigmentosa type 56 and maculopathy, IMPG2-related. [provided by RefSeq, Mar 2011]
• Synonyms: IPM200; RP56; SPACRCAN; VMD5
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane