DNAJB11 Rabbit Polyclonal Antibody

CAT#: TA342009

Rabbit Polyclonal Anti-DNAJB11 Antibody

Product Images

WB Suggested Anti-DNAJB11 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DNAJB11 antibody: synthetic peptide directed towards the C terminal of human DNAJB11. Synthetic peptide located within the following region: FDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: DnaJ heat shock protein family (Hsp40) member B11
• Database Link:
  NP_057390
  Entrez Gene 51726 Human
  UniProt ID Q9UBS4
• Background: This gene encodes a soluble glycoprotein ofThe endoplasmic reticulum (ER) lumen that functions as a co-chaperone of binding immunoglobulin protein, a 70 kilodalton heat shock protein chaperone required forThe proper folding and assembly of proteins inThe ER.The encoded protein contains a highly conserved J domain of about 70 amino acids with a characteristic His-Pro-Asp (HPD) motif and may regulateThe activity of binding immunoglobulin protein by stimulating ATPase activity. [provided by RefSeq, Mar 2014]
• Synonyms: ABBP-2; ABBP2; Dj-9; DJ9; EDJ; ERdj3; ERj3; ERj3p; PRO1080; UNQ537
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Mouse: 93%; Rabbit: 93%

Reference Data

• Protein Families: Transmembrane