Glycoprotein VI (GP6) Rabbit Polyclonal Antibody

CAT#: TA342010

Rabbit Polyclonal Anti-GP6 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GP6 antibody: synthetic peptide directed towards the middle region of human GP6. Synthetic peptide located within the following region: PPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 37 kDa
Gene Name glycoprotein VI platelet
Background This gene encodes a platelet membrane glycoprotein ofThe immunoglobulin superfamily.The encoded protein is a receptor for collagen and plays a critical role in collagen-induced platelet aggregation and thrombus formation.The encoded protein forms a complex withThe Fc receptor gamma-chain that initiatesThe platelet activation signaling cascade upon collagen binding. Mutations inThis gene are a cause of platelet-type bleeding disorder-11 (BDPLT11). Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, Dec 2011]
Synonyms BDPLT11; GPIV; GPVI
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways ECM-receptor interaction

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.