TMEM138 Rabbit Polyclonal Antibody

CAT#: TA342013

Rabbit Polyclonal Anti-TMEM138 Antibody

Product Images

WB Suggested Anti-TMEM138 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM138 antibody: synthetic peptide directed towards the N terminal of human TMEM138. Synthetic peptide located within the following region: MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLVLFIIQDIAVL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: transmembrane protein 138
• Database Link:
  NP_057548
  Entrez Gene 51524 Human
  UniProt ID Q9NPI0
• Background: This gene encodes a multi-pass transmembrane protein. Reduced expression ofThis gene in mouse fibroblasts causes short cilia and failure of ciliogenesis. Expression ofThis gene is tightly coordinated with expression ofThe neighboring gene TMEM216. Mutations inThis gene are associated withThe autosomal recessive neurodevelopmental disorder Joubert Syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2012]
• Synonyms: HSPC196
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 79%; Pig: 79%; Rat: 79%; Goat: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%; Rabbit: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane