C2GNT3 (GCNT4) Rabbit Polyclonal Antibody

CAT#: TA342019

Rabbit Polyclonal Anti-GCNT4 Antibody

Product Images

WB Suggested Anti-GCNT4 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate.GCNT4 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GCNT4 antibody: synthetic peptide directed towards the C terminal of human GCNT4. Synthetic peptide located within the following region: SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: glucosaminyl (N-acetyl) transferase 4, core 2
• Database Link:
  NP_057675
  Entrez Gene 51301 Human
• Background: GCNT4 is a glycosyltransferase that mediates core 2 O-glycan branching, an important step in mucin-type biosynthesis. It does not have core 4 O-glycan or I-branching enzyme activity.
• Synonyms: C2GNT3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 92%; Rat: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, O-Glycan biosynthesis