C2GNT3 (GCNT4) Rabbit Polyclonal Antibody
Other products for "GCNT4"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GCNT4 antibody: synthetic peptide directed towards the C terminal of human GCNT4. Synthetic peptide located within the following region: SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 53 kDa |
Gene Name | glucosaminyl (N-acetyl) transferase 4, core 2 |
Database Link | |
Background | GCNT4 is a glycosyltransferase that mediates core 2 O-glycan branching, an important step in mucin-type biosynthesis. It does not have core 4 O-glycan or I-branching enzyme activity. |
Synonyms | C2GNT3 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 92%; Rat: 86% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Metabolic pathways, O-Glycan biosynthesis |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.