DLL3 Rabbit Polyclonal Antibody

CAT#: TA342025

Rabbit Polyclonal Anti-DLL3 Antibody

Product Images

Host: Rabbit; Target Name: DLL3; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DLL3 antibody is: synthetic peptide directed towards the C-terminal region of Human DLL3. Synthetic peptide located within the following region: LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: delta like canonical Notch ligand 3
• Database Link:
  NP_982353
  Entrez Gene 10683 Human
  UniProt ID Q9NYJ7
• Background: This gene encodes a member ofThe delta protein ligand family.This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations inThis gene cause autosomal recessive spondylocostal dysostosis 1. Two transcript variants encoding distinct isoforms have been identified forThis gene. [provided by RefSeq, Jul 2008]
• Synonyms: SCDO1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 86%; Mouse: 79%

Reference Data

• Protein Families: Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transmembrane
• Protein Pathways: Notch signaling pathway