DLL3 Rabbit Polyclonal Antibody

CAT#: TA342026

Rabbit Polyclonal Anti-DLL3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "DLL3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DLL3 antibody: synthetic peptide directed towards the N terminal of human DLL3. Synthetic peptide located within the following region: MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 54 kDa
Gene Name delta like canonical Notch ligand 3
Background This gene encodes a member ofThe delta protein ligand family.This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations inThis gene cause autosomal recessive spondylocostal dysostosis 1. Two transcript variants encoding distinct isoforms have been identified forThis gene. [provided by RefSeq, Jul 2008]
Synonyms SCDO1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Bovine: 93%; Mouse: 86%; Guinea pig: 85%
Reference Data
Protein Families Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transmembrane
Protein Pathways Notch signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.