SMPD4 Rabbit Polyclonal Antibody

CAT#: TA342050

Rabbit Polyclonal Anti-Smpd4 Antibody

Product Images

WB Suggested Anti-Smpd4 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Testis

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Smpd4 antibody is: synthetic peptide directed towards the middle region of Rat Smpd4. Synthetic peptide located within the following region: LHSPAQPSLQALHAYQESFMPTEEHVLVVRLLLKHLHAFANSLKPDQASP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: sphingomyelin phosphodiesterase 4
• Database Link:
  NP_060421
  Entrez Gene 303790 Rat
  UniProt ID Q9NXE4
• Background: The function ofThis protein remains unknown.
• Synonyms: NET13; NSMASE-3; NSMASE3
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, Sphingolipid metabolism