PGAP3 Rabbit Polyclonal Antibody
Other products for "PGAP3"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PGAP3 antibody: synthetic peptide directed towards the N terminal of human PGAP3. Synthetic peptide located within the following region: AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 36 kDa |
| Gene Name | post-GPI attachment to proteins 3 |
| Database Link | |
| Background | PGAP3 is involved inThe lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist inThe generation of 2 saturated fatty chains atThe sn-2 position of GPI-anchors proteins. It is required for phospholipase A2 activity that removes an acyl-chain atThe sn-2 position of GPI-anchors duringThe remodeling of GPI. |
| Synonyms | AGLA546; CAB2; hCOS16; PERLD1; PP1498 |
| Note | Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Guinea pig: 93%; Rat: 86%; Zebrafish: 85% |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China