PGAP3 Rabbit Polyclonal Antibody

CAT#: TA342058

Rabbit Polyclonal Anti-PGAP3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PGAP3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PGAP3 antibody: synthetic peptide directed towards the N terminal of human PGAP3. Synthetic peptide located within the following region: AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name post-GPI attachment to proteins 3
Background PGAP3 is involved inThe lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist inThe generation of 2 saturated fatty chains atThe sn-2 position of GPI-anchors proteins. It is required for phospholipase A2 activity that removes an acyl-chain atThe sn-2 position of GPI-anchors duringThe remodeling of GPI.
Synonyms AGLA546; CAB2; hCOS16; PERLD1; PP1498
Note Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Guinea pig: 93%; Rat: 86%; Zebrafish: 85%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.