LY108 (SLAMF6) Rabbit Polyclonal Antibody
Other products for "SLAMF6"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SLAMF6 antibody: synthetic peptide directed towards the N terminal of human SLAMF6. Synthetic peptide located within the following region: NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 34 kDa |
Gene Name | SLAM family member 6 |
Database Link | |
Background | SLAMF6 is a type I transmembrane protein, belonging toThe CD2 subfamily ofThe immunoglobulin superfamily. SLAMF6 is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates withThe Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor inThe process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.The protein encoded byThis gene is a type I transmembrane protein, belonging toThe CD2 subfamily ofThe immunoglobulin superfamily.This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates withThe Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor inThe process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Entrez Gene record to access additional publications. |
Synonyms | CD352; KALI; KALIb; Ly108; NTB-A; NTBA; SF2000 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.