LY108 (SLAMF6) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 276-305 amino acids from the C-terminal region of Human SLAMF6 |
LY108 (SLAMF6) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 276-305 amino acids from the C-terminal region of Human SLAMF6 |
Rabbit Polyclonal Anti-SLAMF6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLAMF6 antibody: synthetic peptide directed towards the N terminal of human SLAMF6. Synthetic peptide located within the following region: NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK |
Rabbit Polyclonal Anti-SLAMF6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLAMF6 antibody: synthetic peptide directed towards the N terminal of human SLAMF6. Synthetic peptide located within the following region: EIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYT |
SLAMF6 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SLAMF6 |
Modifications | Unmodified |