TCEAL8 Rabbit Polyclonal Antibody

CAT#: TA342115

Rabbit Polyclonal Anti-TCEAL8 Antibody

Product Images

WB Suggested Anti-TCEAL8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCEAL8 antibody: synthetic peptide directed towards the middle region of human TCEAL8. Synthetic peptide located within the following region: PQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELER
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: transcription elongation factor A like 8
• Database Link:
  NP_001006685
  Entrez Gene 90843 Human
  UniProt ID Q8IYN2
• Background: TCEAL8 is a member ofThe transcription elongation factor A (SII)-like (TCEAL) gene family. Members ofThis family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner.This gene encodes a member ofThe transcription elongation factor A (SII)-like (TCEAL) gene family. Members ofThis family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located onThe X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform.
• Synonyms: WEX3
• Note: Immunogen Sequence Homology: Human: 100%