MAPK6 Rabbit Polyclonal Antibody

CAT#: TA342152

Rabbit polyclonal Anti-MAPK6 Antibody

Product Images

WB Suggested Anti-MAPK6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAPK6 antibody: synthetic peptide directed towards the middle region of human MAPK6. Synthetic peptide located within the following region: QVDPRKYLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSHTC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 83 kDa
• Gene Name: mitogen-activated protein kinase 6
• Database Link:
  NP_002739
  Entrez Gene 5597 Human
  UniProt ID Q16659
• Background: The protein encoded byThis gene is a member ofThe Ser/Thr protein kinase family, and is most closely related to mitogen-activated protein kinases (MAP kinases). MAP kinases also known as extracellular signal-regulated kinases (ERKs), are activated through protein phosphorylation cascades and act as integration points for multiple biochemical signals.This kinase is localized inThe nucleus, and has been reported to be activated in fibroblasts upon treatment with serum or phorbol esters. [provided by RefSeq, Jul 2008]
• Synonyms: ERK3; HsT17250; p97MAPK; PRKM6
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase