Trypsin (PRSS3) Rabbit Polyclonal Antibody

CAT#: TA342157

Rabbit polyclonal Anti-PRSS3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PRSS3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PRSS3 antibody: synthetic peptide directed towards the N terminal of human PRSS3. Synthetic peptide located within the following region: VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 33 kDa
Gene Name protease, serine 3
Background This gene encodes a trypsinogen, which is a member ofThe trypsin family of serine proteases.This enzyme is expressed inThe brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involvingThe carboxyl group of lysine or arginine.This gene is localized toThe locus of T cell receptor beta variable orphans on chromosome 9. Four transcript variants encoding different isoforms have been described forThis gene. [provided by RefSeq, Oct 2010]
Synonyms MTG; PRSS4; T9; TRY3; TRY4
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Bovine: 91%
Reference Data
Protein Families Druggable Genome, Protease, Secreted Protein
Protein Pathways Neuroactive ligand-receptor interaction

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.