PSMB5 Rabbit Polyclonal Antibody

CAT#: TA342169

Rabbit polyclonal Anti-PSMB5 Antibody

Product Images

WB Suggested Anti-PSMB5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysatePSMB5 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSMB5 antibody: synthetic peptide directed towards the middle region of human PSMB5. Synthetic peptide located within the following region: IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: proteasome subunit beta 5
• Database Link:
  NP_002788
  Entrez Gene 5693 Human
  UniProt ID P28074
• Background: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome,The immunoproteasome, isThe processing of class I MHC peptides.This gene encodes a member ofThe proteasome B-type family, also known asThe T1B family, that is a 20S core beta subunit inThe proteasome.This catalytic subunit is not present inThe immunoproteasome and is replaced by catalytic subunit 3i (proteasome beta 8 subunit). Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jan 2009]
• Synonyms: LMPX; MB1; X
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 92%

Reference Data

• Protein Families: Protease
• Protein Pathways: Proteasome