Pentraxin 3 (PTX3) Rabbit Polyclonal Antibody

CAT#: TA342182

Rabbit polyclonal Anti-PTX3 Antibody

Product Images

WB Suggested Anti-PTX3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PTX3 antibody: synthetic peptide directed towards the N terminal of human PTX3. Synthetic peptide located within the following region: MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: pentraxin 3
• Database Link:
  NP_002843
  Entrez Gene 5806 Human
  UniProt ID P26022
• Background: Plays a role inThe regulation of innate resistance to pathogens, inflammatory reactions, possibly clearance of self-components and female fertility.
• Synonyms: TNFAIP5; TSG-14
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Dog: 83%; Guinea pig: 80%

Reference Data

• Protein Families: Secreted Protein