NDUFA9 Rabbit Polyclonal Antibody

CAT#: TA342228

Rabbit polyclonal Anti-NDUFA9 Antibody

Product Images

WB Suggested Anti-NDUFA9 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:2500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NDUFA9 antibody: synthetic peptide directed towards the N terminal of human NDUFA9. Synthetic peptide located within the following region: QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: NADH:ubiquinone oxidoreductase subunit A9
• Database Link:
  NP_004993
  Entrez Gene 4704 Human
  UniProt ID Q16795
• Background: The encoded protein is a subunit ofThe hydrophobic protein fraction ofThe NADH:ubiquinone oxidoreductase (complex I),The first enzyme complex inThe electron transport chain located inThe inner mitochondrial membrane. A pseudogene has been identified on chromosome 12. [provided by RefSeq, May 2010]
• Synonyms: CC6; CI-39k; CI39k; NDUFS2L; SDR22E1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%; Yeast: 92%; Guinea pig: 92%

Reference Data

• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease