MRE11 Rabbit Polyclonal Antibody

CAT#: TA342247

Rabbit polyclonal Anti-MRE11A Antibody


USD 375.00

2 Weeks*

Size
    • 100 ul

Product Images

Other products for "MRE11"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MRE11A antibody: synthetic peptide directed towards the N terminal of human MRE11A. Synthetic peptide located within the following region: DTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCM
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 80 kDa
Gene Name MRE11 homolog A, double strand break repair nuclease
Background This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself,The protein has 3' to 5' exonuclease activity and endonuclease activity.The protein forms a complex withThe RAD50 homolog;This complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase,This protein promotesThe joining of noncomplementary ends in vitro using short homologies nearThe ends ofThe DNA fragments.This gene has a pseudogene on chromosome 3. Alternative splicing ofThis gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Synonyms ATLD; HNGS1; MRE11; MRE11B
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Zebrafish: 93%
Reference Data
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Homologous recombination, Non-homologous end-joining

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.