MRE11 Rabbit Polyclonal Antibody

CAT#: TA342248

Rabbit polyclonal Anti-MRE11A Antibody

Product Images

WB Suggested Anti-MRE11A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MRE11A antibody: synthetic peptide directed towards the middle region of human MRE11A. Synthetic peptide located within the following region: RFRETRQKNTNEEDDEVREAMTRARALRSQSEESASAFSADDLMSIDLAE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 80 kDa
• Gene Name: MRE11 homolog A, double strand break repair nuclease
• Database Link:
  NP_005582
  Entrez Gene 4361 Human
  UniProt ID P49959
• Background: This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself,The protein has 3' to 5' exonuclease activity and endonuclease activity.The protein forms a complex withThe RAD50 homolog;This complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase,This protein promotesThe joining of noncomplementary ends in vitro using short homologies nearThe ends ofThe DNA fragments.This gene has a pseudogene on chromosome 3. Alternative splicing ofThis gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Synonyms: ATLD; HNGS1; MRE11; MRE11B
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Homologous recombination, Non-homologous end-joining