NIT1 Rabbit Polyclonal Antibody

CAT#: TA342249

Rabbit polyclonal Anti-NIT1 Antibody

Product Images

WB Suggested Anti-NIT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NIT1 antibody: synthetic peptide directed towards the N terminal of human NIT1. Synthetic peptide located within the following region: VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: nitrilase 1
• Database Link:
  NP_005591
  Entrez Gene 4817 Human
  UniProt ID Q86X76
• Background: This gene encodes a member ofThe nitrilase protein family with homology to bacterial and plant nitrilases, enzymes that cleave nitriles and organic amides toThe corresponding carboxylic acids plus ammonia. Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jun 2010]
• Synonyms: MGC57670
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%