RbAp48 (RBBP4) Rabbit Polyclonal Antibody

CAT#: TA342252

Rabbit polyclonal Anti-Rbbp4 Antibody

Product Images

Host: Rabbit; Target Name: Rbbp4; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Rbbp4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rbbp4. Synthetic peptide located within the following region: TAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: RB binding protein 4, chromatin remodeling factor
• Database Link:
  NP_005601
  Entrez Gene 19646 Mouse
  UniProt ID Q09028
• Background: Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases toTheir histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism.These includeThe chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair;The core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression;The nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; andThe PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; andThe NURF (nucleosome remodeling factor) complex.
• Synonyms: lin-53; NURF55; RBAP48
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors