RbAp48 (RBBP4) Rabbit Polyclonal Antibody
Other products for "RBBP4"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Rbbp4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rbbp4. Synthetic peptide located within the following region: TAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 47 kDa |
Gene Name | RB binding protein 4, chromatin remodeling factor |
Database Link | |
Background | Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases toTheir histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism.These includeThe chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair;The core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression;The nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; andThe PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; andThe NURF (nucleosome remodeling factor) complex. |
Synonyms | lin-53; NURF55; RBAP48 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.